Pfam domain
Pfam family: DNA_ligase_A_N (PF04675.16)
Uniprot AC: P49917
RecName: DNA ligase 4
Begin-End: 15-208
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
PFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQ
LERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLK
PRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDL
KLGVSQQTIFSVFH
Structures of the domain P49917 15-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bkf X-ray 3.25 A 15-208  H-Bb L-Bb 
6bkg X-ray 2.4 A 15-208  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text