Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.23)
Uniprot AC: P49917
RecName: DNA ligase 4
Begin-End: 248-451
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb L-Mn 

Sequence:
PMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPT
EGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVF
DVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREE
GIMVKQPLSIYKPDKRGEGWLKIK
Structures of the domain P49917 248-451
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bkf X-ray 3.25 A 341-451  S-Bb L-Bb 
6bkg X-ray 2.4 A 248-451  S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text