Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P49960
RecName: U4/U6 snRNA-associated-splicing factor PRP24
Begin-End: 212-283
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQ
MNRSLLGNREIS
Structures of the domain P49960 212-283
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 A 212-282 None
6aso X-ray 2.71 A 212-282 None
4n0t X-ray 1.7 A 212-282 None
5tf6 X-ray 2.3 A 212-282 None
5tf6 X-ray 2.3 C 212-282 None


© NPIDB team 2003 - 2019

text