Pfam domain
Pfam family: UCH (PF00443.28)
Uniprot AC: P50102
RecName: Ubiquitin carboxyl-terminal hydrolase 8
Begin-End: 137-465
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYG
ALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLD
LPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKL
YECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKL
DDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISG
GQWFKFNDSMVSSISQEEVLKEQAYLLFY
Structures of the domain P50102 137-465
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4zux X-ray 3.82 Z 138-465 None
4zux X-ray 3.82 U 138-465 None
4zux X-ray 3.82 j 65-465 None
4zux X-ray 3.82 e 138-465 None


© NPIDB team 2003 - 2019

text