Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: P50465
RecName: Endonuclease 8
Begin-End: 126-215
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNH
KAKDLNAAQLDALAHALLEIPRFSYATRGQ
Structures of the domain P50465 126-215
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ea0 X-ray 1.4 A 126-204 None
1k3w X-ray 1.42 A 126-204 None
1k3x X-ray 1.25 A 126-204 None
2oq4 X-ray 2.6 B 126-204 None
2oq4 X-ray 2.6 A 126-204 None
2opf X-ray 1.85 A 126-204 None


© NPIDB team 2003 - 2019

text