Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P50465
RecName: Endonuclease 8
Begin-End: 126-215
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
VGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNH
KAKDLNAAQLDALAHALLEIPRFSYATRGQ
Structures of the domain P50465 126-215
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ea0 X-ray 1.4 A 125-225  H-Bb L-Bb 
1k3x X-ray 1.25 A 125-226  H-Bb L-Bb 
2oq4 X-ray 2.6 B 125-228  L-Bb 
2oq4 X-ray 2.6 A 125-213  H-Bb L-Bb 
2opf X-ray 1.85 A 125-214  H-Bb L-Bb 
1k3w X-ray 1.42 A 125-225  H-Bb L-Bb 
6fbu X-ray 2 A 125-225  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text