Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.23)
Uniprot AC: P50465
RecName: Endonuclease 8
Begin-End: 2-107
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKPYQSQLIGQHVTHVETRGKALLTHFSN
DLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSAS
Structures of the domain P50465 2-107
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ea0 X-ray 1.4 A 1-103 None
1k3w X-ray 1.42 A 1-103 None
1k3x X-ray 1.25 A 1-103 None
2oq4 X-ray 2.6 B 1-103 None
2oq4 X-ray 2.6 A 1-103 None
2opf X-ray 1.85 A 1-103 None


© NPIDB team 2003 - 2019

text