Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P50549
RecName: ETS translocation variant 1
Begin-End: 336-415
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
QLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRY
YYEKGIMQKVAGERYVYKFV
Structures of the domain P50549 336-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4bnc X-ray 2.9 A 336-415  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text