Pfam domain
Pfam family: ORC5_C (PF14630.8)
Uniprot AC: P50874
RecName: Origin recognition complex subunit 5
Begin-End: 187-474
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFIHLIVQA
FHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGE
SAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRR
KKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEVFQNLSE
LHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYF
Structures of the domain P50874 187-474
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 E 187-474  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text