Pfam domain
Pfam family: AAA_22 (PF13401.8)
Uniprot AC: P50874
RecName: Origin recognition complex subunit 5
Begin-End: 28-177
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIARTVQYKLKT
LYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFN
KYIKLNELLPKDSKINIKFIYTMLETSFLQ
Structures of the domain P50874 28-177
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 E 28-177  H-Bb 
6wgg X-ray 8.1 E 28-177  H-Bb 
6wgi X-ray 10 E 28-177 None
5v8f X-ray 3.9 E 28-177 None
6wgc X-ray 4.3 E 28-177  H-Bb 


© NPIDB team 2003 - 2021

text