Pfam domain
Pfam family: Skp1_POZ (PF03931.17)
Uniprot AC: P52286
RecName: Suppressor of kinetochore protein 1
Begin-End: 2-59
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKS
Structures of the domain P52286 2-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gys X-ray 4.4 K 4-99 None
6gys X-ray 4.4 D 4-99 None


© NPIDB team 2003 - 2021

text