Pfam domain
Pfam family: RNA_pol_Rpb8 (PF03870.14)
Uniprot AC: P52434
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC3
Begin-End: 7-147
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYE
DGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQ
GDANNLHGFEVDSRVYLLMKK
Structures of the domain P52434 7-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 H 7-147 None
5iya X-ray 5.4 H 7-147 None
5iy8 X-ray 7.9 H 7-147 None
5iyd X-ray 3.9 H 7-147 None
5iy6 X-ray 7.2 H 7-147 None
5iyc X-ray 3.9 H 7-147 None
5iy9 X-ray 6.3 H 7-147 None
5iyb X-ray 3.9 H 7-147 None


© NPIDB team 2003 - 2019

text