Pfam domain
Pfam family: RNA_pol_L_2 (PF13656.5)
Uniprot AC: P52435
RecName: DNA-directed RNA polymerase II subunit RPB11-a
Begin-End: 30-104
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTN
AITDLISELSLLEER
Structures of the domain P52435 30-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 K 31-103 None
5iya X-ray 5.4 K 31-103 None
5iy8 X-ray 7.9 K 31-103 None
5iyd X-ray 3.9 K 31-103 None
5iy6 X-ray 7.2 K 31-103 None
5iyc X-ray 3.9 K 31-103 None
5iy9 X-ray 6.3 K 31-103 None
5iyb X-ray 3.9 K 31-103 None


© NPIDB team 2003 - 2019

text