Pfam domain
Pfam family: TFIIA (PF03153.12)
Uniprot AC: P52655
RecName: Transcription initiation factor IIA subunit 1
Begin-End: 13-51
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Structures of the domain P52655 13-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 N 13-51 None
5iya X-ray 5.4 N 13-51 None
1nvp X-ray 2.1 B 13-51 None
5fur X-ray 8.5 B 13-51 None
5iy8 X-ray 7.9 N 13-51 None
5iyd X-ray 3.9 N 13-51 None
5iy6 X-ray 7.2 N 13-51 None
5iyc X-ray 3.9 N 13-51 None
5iy9 X-ray 6.3 N 13-51 None
5iyb X-ray 3.9 N 13-51 None


© NPIDB team 2003 - 2019

text