Pfam domain
Pfam family: TFIIA (PF03153.12)
Uniprot AC: P52655
RecName: Transcription initiation factor IIA subunit 1
Begin-End: 307-376
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
GQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYI
FSKAIGDAEW
Structures of the domain P52655 307-376
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 N 308-376  S-Bb 
5iya X-ray 5.4 N 308-376  L-Bb 
5iy8 X-ray 7.9 N 308-376  S-Bb L-Bb 
5iyd X-ray 3.9 N 308-376 None
5iy6 X-ray 7.2 N 308-376  L-Bb 
5iyc X-ray 3.9 N 308-376  S-Bb L-Bb 
5iy9 X-ray 6.3 N 308-376 None
5iyb X-ray 3.9 N 308-376  S-Bb 


© NPIDB team 2003 - 2019

text