Pfam domain
Pfam family: TFIIA (PF03153.12)
Uniprot AC: P52655
RecName: Transcription initiation factor IIA subunit 1
Begin-End: 330-376
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb 

Sequence:
DTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Structures of the domain P52655 330-376
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nvp X-ray 2.1 C 330-376  S-Bb L-Bb 
5fur X-ray 8.5 C 330-376  S-Bb L-Bb 


© NPIDB team 2003 - 2020

text