Pfam domain
Pfam family: TFIIA_gamma_C (PF02751.13)
Uniprot AC: P52657
RecName: Transcription initiation factor IIA subunit 2
Begin-End: 57-99
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Structures of the domain P52657 57-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 O 52-99 None
5iya X-ray 5.4 O 52-99 None
1nvp X-ray 2.1 D 52-99 None
5fur X-ray 8.5 D 52-99 None
5iy8 X-ray 7.9 O 52-99 None
5iyd X-ray 3.9 O 52-99 None
5iy6 X-ray 7.2 O 52-99 None
5iyc X-ray 3.9 O 52-99 None
5iy9 X-ray 6.3 O 52-99 None
5iyb X-ray 3.9 O 52-99 None


© NPIDB team 2003 - 2019

text