Pfam domain
Pfam family: MutS_III (PF05192.17)
Uniprot AC: P52701
RecName: DNA mismatch repair protein Msh6
Begin-End: 738-1064
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIED
LMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIID
FLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFD
HEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRY
QLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLF
YNFDKNYKDWQSAVECIAVLDVLLCLA
Structures of the domain P52701 738-1064
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o8f X-ray 3.25 B 739-1064 None
2o8b X-ray 2.75 B 739-1064 None
2o8c X-ray 3.37 B 739-1064 None
2o8d X-ray 3 B 739-1064 None
2o8e X-ray 3.3 B 739-1064 None


© NPIDB team 2003 - 2019

text