Pfam domain
Pfam family: BRCT_2 (PF16589.4)
Uniprot AC: P53261
RecName: Pescadillo homolog
Begin-End: 357-437
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVDRPV
LKNKVAGRTYIQPQWIFDCIN
Structures of the domain P53261 357-437
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 n 358-436 None
6em3 X-ray 3.2 n 358-436 None


© NPIDB team 2003 - 2019

text