Pfam domain
Pfam family: Pescadillo_N (PF06732.10)
Uniprot AC: P53261
RecName: Pescadillo homolog
Begin-End: 5-267
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKKKANKGSTAPTTFYY
AKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSAKRLEENRDSYTLDHIIKERYPS
FPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVAKERLVRKVFVSIK
GVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIY
PPKLDLKKDKIISGLSSYILESR
Structures of the domain P53261 5-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 n 5-352 None


© NPIDB team 2003 - 2019

text