Pfam domain
Pfam family: MA3 (PF02847.16)
Uniprot AC: P53333
RecName: Pre-mRNA-splicing factor CWC22
Begin-End: 291-398
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
FKKKIYLVLKSSLSGDEAAHKLLKLKIANNLKKSVVDIIIKSSLQESTFSKFYSILSERM
ITFHRSWQTAYNETFEQNYTQDIEDYETDQLRILGKFWGHLISYEFLP
Structures of the domain P53333 291-398
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 Z 291-398 None
5gmk X-ray 3.4 Z 291-398 None
6bk8 X-ray 3.3 L 291-398 None
5mps X-ray 3.85 H 291-398 None


© NPIDB team 2003 - 2019

text