Pfam domain
Pfam family: PAS_11 (PF14598.5)
Uniprot AC: P53762
RecName: Aryl hydrocarbon receptor nuclear translocator
Begin-End: 361-464
Organism: Mus musculus
Interaction Mode:   

Sequence:
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Structures of the domain P53762 361-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4zpk X-ray 3.6 A 362-462 None
5sy7 X-ray 4.2 A 362-462 None
4zpr X-ray 3.9 A 361-462 None


© NPIDB team 2003 - 2019

text