Pfam domain
Pfam family: EXOSC1 (PF10447.8)
Uniprot AC: P53859
RecName: Exosome complex component CSL4
Begin-End: 132-237
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LPKEGDIVLTRVTRLSLQRANVEILAVEDKPSPIDSGIGSNGSGIVAAGGGSGAATFSVS
QASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSL
Structures of the domain P53859 132-237
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jea X-ray 2.65 I 132-237 None


© NPIDB team 2003 - 2019

text