Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P53905
RecName: U6 snRNA-associated Sm-like protein LSm7
Begin-End: 28-104
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSNPDDENNTELISKNAR
KLGLTVIRGTILVSLSS
Structures of the domain P53905 28-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 G 29-103 None
6aso X-ray 2.71 G 29-103 None
4m7a X-ray 2.78 M 29-103 None
4m7a X-ray 2.78 F 29-103 None
4m7a X-ray 2.78 M 29-103 None
4m7a X-ray 2.78 F 29-103 None
4m7d X-ray 2.6 M 29-103 None
4m7d X-ray 2.6 F 29-103 None
3jcm X-ray 3.8 g 7-120 None


© NPIDB team 2003 - 2019

text