Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P53927
RecName: Ribosome biogenesis protein 15
Begin-End: 93-163
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESM
NNYLLMGHLLQ
Structures of the domain P53927 93-163
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 o 8-77 None
6em3 X-ray 3.2 o 8-77 None
6em5 X-ray 4.3 o 93-162 None


© NPIDB team 2003 - 2019

text