Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P54030
RecName: 50S ribosomal protein L11
Begin-End: 2-64
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
AKEVVEVLVTGGRATAGPPLGPAIGPLGVNVMQVVKEINEKTKDYEGMQVPVKVIVDTET
RKF
Structures of the domain P54030 2-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dar X-ray 2.9 C 5-59 None
5dar X-ray 2.9 F 5-59 None


© NPIDB team 2003 - 2019

text