Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P54049
RecName: 50S ribosomal protein L10
Begin-End: 10-112
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
APWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALK
EAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKS
Structures of the domain P54049 10-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dar X-ray 2.9 B 11-110 None
5dar X-ray 2.9 E 12-110 None
5d6g X-ray 3.3 A 12-110 None


© NPIDB team 2003 - 2019

text