Pfam domain
Pfam family: DNA_pol_A (PF00476.19)
Uniprot AC: P54098
RecName: DNA polymerase subunit gamma-1
Begin-End: 754-1185
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
HKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNAHKRISSQMV
VWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDRVGSE
LKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHS
KTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLR
WYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGT
ESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLML
VAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDL
PQSVAFFSAVDI
Structures of the domain P54098 754-1185
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ztz X-ray 3.44 A 764-1182  H-Bb S-Bb L-Bb L-Mn 
5c53 X-ray 3.57 A 764-1182  H-Bb L-Bb L-Mn 
5c51 X-ray 3.43 A 764-1182 None
5c52 X-ray 3.64 A 764-1182  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text