Pfam domain
Pfam family: RQC (PF09382.12)
Uniprot AC: P54132
RecName: Bloom syndrome protein
Begin-End: 1071-1193
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
DYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGI
FGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFM
ETE
Structures of the domain P54132 1071-1193
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3m X-ray 2.3 A 1068-1210  S-Bb L-Bb L-Mj L-Mn 
4cgz X-ray 3.2 A 1071-1211  S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text