Pfam domain
Pfam family: HRDC (PF00570.25)
Uniprot AC: P54132
RecName: Bloom syndrome protein
Begin-End: 1215-1282
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKY
GAEVISVL
Structures of the domain P54132 1215-1282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3m X-ray 2.3 A 1215-1282 None
4cgz X-ray 3.2 A 1215-1282 None
7aud X-ray 2.96 E 1215-1282 None
7aud X-ray 2.96 B 1215-1282 None
7aud X-ray 2.96 C 1215-1282 None
7aud X-ray 2.96 A 1215-1282 None
7aud X-ray 2.96 D 1215-1282 None
7aud X-ray 2.96 F 1215-1282 None


© NPIDB team 2003 - 2021

text