Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: P54132
RecName: Bloom syndrome protein
Begin-End: 669-841
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLT
SLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKL
LARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDI
Structures of the domain P54132 669-841
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3m X-ray 2.3 A 669-841 None
4cgz X-ray 3.2 A 669-841 None
7aud X-ray 2.96 E 669-841 None
7aud X-ray 2.96 B 669-841 None
7aud X-ray 2.96 C 669-841 None
7aud X-ray 2.96 A 669-841 None
7aud X-ray 2.96 D 669-841 None
7aud X-ray 2.96 F 669-841 None


© NPIDB team 2003 - 2021

text