Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P54132
RecName: Bloom syndrome protein
Begin-End: 874-984
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQK
WINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDG
Structures of the domain P54132 874-984
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3m X-ray 2.3 A 883-983 None
4cgz X-ray 3.2 A 883-983 None


© NPIDB team 2003 - 2019

text