Pfam domain
Pfam family: RecQ_Zn_bind (PF16124.7)
Uniprot AC: P54132
RecName: Bloom syndrome protein
Begin-End: 995-1067
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDF
CKKHPDVSCDNCC
Structures of the domain P54132 995-1067
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3m X-ray 2.3 A 995-1067 None
4cgz X-ray 3.2 A 995-1067 None
7aud X-ray 2.96 E 995-1067 None
7aud X-ray 2.96 B 995-1067 None
7aud X-ray 2.96 C 995-1067 None
7aud X-ray 2.96 A 995-1067 None
7aud X-ray 2.96 D 995-1067 None
7aud X-ray 2.96 F 995-1067 None


© NPIDB team 2003 - 2021

text