Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: P54274
RecName: Telomeric repeat-binding factor 1
Begin-End: 380-428
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMK
Structures of the domain P54274 380-428
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1iv6 NMR A 380-428  H-Bb H-Mj L-Bb L-Mn 
1w0t X-ray 2 B 380-428  H-Bb H-Mj L-Bb L-Mn 
1w0t X-ray 2 A 380-428  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2020

text