Pfam domain
Pfam family: AAA_lid_10 (PF17872.3)
Uniprot AC: P54784
RecName: Origin recognition complex subunit 1
Begin-End: 637-730
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKV
ASVSGDARRALKVCKRAAEIAEKHYMAKHGYGYD
Structures of the domain P54784 637-730
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 A 637-775 None
6wgg X-ray 8.1 A 637-775 None
6wgi X-ray 10 A 637-775 None
5v8f X-ray 3.9 A 637-775 None
6wgc X-ray 4.3 A 637-775 None


© NPIDB team 2003 - 2021

text