Pfam domain
Pfam family: ORC_WH_C (PF18137.3)
Uniprot AC: P54790
RecName: Origin recognition complex subunit 3
Begin-End: 484-613
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIA
FRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTK
SYDLVEKCVW
Structures of the domain P54790 484-613
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zr1 X-ray 3 C 484-613 None
6wgg X-ray 8.1 C 484-613 None
6wgi X-ray 10 C 484-613 None
5v8f X-ray 3.9 C 484-613 None
6wgc X-ray 4.3 C 484-613 None


© NPIDB team 2003 - 2021

text