Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P54999
RecName: Small nuclear ribonucleoprotein F
Begin-End: 17-83
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCN
NVLYIRE
Structures of the domain P54999 17-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 H 18-82 None
5wsg X-ray 4 h 18-82 None
5gmk X-ray 3.4 h 8-70 None
5gmk X-ray 3.4 w 18-82 None
6bk8 X-ray 3.3 b 18-82 None
6bk8 X-ray 3.3 m 56-197 None
5lj3 X-ray 3.8 q 18-82 None
5lj3 X-ray 3.8 f 18-82 None
5mps X-ray 3.85 f 18-82 None
5lj5 X-ray 3.8 q 344-408 None
5lj5 X-ray 3.8 f 9-82 None
3jcm X-ray 3.8 Z 18-82 None
3jcm X-ray 3.8 W 18-82 None
5gam X-ray 3.7 f 18-82 None
5uz5 X-ray 3.56 P 18-82 None
5gao X-ray 3.6 q 18-82 None


© NPIDB team 2003 - 2019

text