Pfam domain
Pfam family: Hormone_recep (PF00104.32)
Uniprot AC: P55055
RecName: Oxysterols receptor LXR-beta
Begin-End: 256-444
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLET
ARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAI
NIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHS
EQVFALRLQ
Structures of the domain P55055 256-444
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nqa X-ray 3.1 I 257-445 None
4nqa X-ray 3.1 B 257-445 None


© NPIDB team 2003 - 2021

text