Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P55055
RecName: Oxysterols receptor LXR-beta
Begin-End: 85-156
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
ELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQC
RLRKCKEAGMRE
Structures of the domain P55055 85-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nqa X-ray 3.1 B 86-155  H-Bb H-Mj S-Bb S-Mj L-Bb 
4nqa X-ray 3.1 I 86-155  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text