Pfam domain
Pfam family: MFAP1 (PF06991.10)
Uniprot AC: P55081
RecName: Microfibrillar-associated protein 1
Begin-End: 270-314
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEE
Structures of the domain P55081 270-314
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o9z X-ray 4.5 K 5-48 None


© NPIDB team 2003 - 2019

text