Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: P55318
RecName: Hepatocyte nuclear factor 3-gamma
Begin-End: 116-202
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
AKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCF
VKVARSPDKPGKGSYWALHPSSGNMFE
Structures of the domain P55318 116-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1vtn X-ray 2.5 C 119-203  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text