Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P55769
RecName: NHP2-like protein 1
Begin-End: 20-114
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVP
YVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQ
Structures of the domain P55769 20-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1e7k X-ray 2.9 B 21-111 None
1e7k X-ray 2.9 A 21-111 None
2ozb X-ray 2.6 A 21-111 None
2ozb X-ray 2.6 D 21-111 None
3siu X-ray 2.63 A 21-111 None
3siu X-ray 2.63 D 21-111 None
3siv X-ray 3.3 D 21-111 None
3siv X-ray 3.3 A 21-111 None
3siv X-ray 3.3 G 21-111 None
3siv X-ray 3.3 J 21-111 None
3jcr X-ray 7 I 21-111 None
5o9z X-ray 4.5 O 21-111 None


© NPIDB team 2003 - 2019

text