Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P55858
RecName: 50S ribosomal protein L7Ae
Begin-End: 17-111
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
DKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIP
YVYVSSKKALGEACGLQVATASAAILEPGEAKDLV
Structures of the domain P55858 17-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3id5 X-ray 4.01 G 20-114 None
3id5 X-ray 4.01 C 20-114 None
5gip X-ray 3.13 D 20-114 None
5gip X-ray 3.13 C 20-114 None
5gip X-ray 3.13 M 20-114 None
5gip X-ray 3.13 N 20-114 None


© NPIDB team 2003 - 2019

text