Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: P55873
RecName: 50S ribosomal protein L20
Begin-End: 3-109
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
RVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKLWI
TRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQL
Structures of the domain P55873 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 Q 3-109 None
3j3w X-ray 10.7 Q 3-109 None


© NPIDB team 2003 - 2019

text