Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: P56347
RecName: DNA endonuclease I-CvuI
Begin-End: 15-116
Organism: Chlorella vulgaris
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTRHFILLDIQKILGCGTVRKRND
GMSEFCVVGGTSLQTTLEKLLPYLQLKRAQAKLVLQIIKKLP
Structures of the domain P56347 15-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a72 X-ray 2.6 B 16-100  S-Bb S-Mj L-Bb L-Mj 
5a72 X-ray 2.6 A 16-100  S-Bb S-Mj L-Bb L-Mj 
5a77 X-ray 2.5 B 16-100  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a77 X-ray 2.5 A 16-100  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a74 X-ray 2.5 A 16-100  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a74 X-ray 2.5 B 16-100  S-Bb S-Mj L-Bb L-Mj 
5a78 X-ray 2.5 B 16-100  H-Bb S-Bb S-Mj L-Bb L-Mj 
5a78 X-ray 2.5 A 16-100  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text