Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P56689
RecName: DNA polymerase
Begin-End: 126-278
Organism: Thermococcus gorgonarius
Interaction Mode:   

Sequence:
LIPMEGDEELKMLAFDIETLYHEGEEFAEGPILMISYADEEGARVITWKNIDLPYVDVVS
TEKEMIKRFLKVVKEKDPDVLITYNGDNFDFAYLKKRSEKLGVKFILGREGSEPKIQRMG
DRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAV
Structures of the domain P56689 126-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vwj X-ray 2.78 A 130-278 None
2xhb X-ray 2.72 A 130-278 None


© NPIDB team 2003 - 2020

text