Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P56689
RecName: DNA polymerase
Begin-End: 20-131
Organism: Thermococcus gorgonarius
Interaction Mode:   

Sequence:
KKENGEFKIDYDRNFEPYIYALLKDDSAIEDVKKITAERHGTTVRVVRAEKVKKKFLGRP
IEVWKLYFTHPQDVPAIRDKIKEHPAVVDIYEYDIPFAKRYLIDKGLIPMEG
Structures of the domain P56689 20-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vwj X-ray 2.78 A 24-129 None
2xhb X-ray 2.72 A 24-129 None


© NPIDB team 2003 - 2020

text