Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P56981
RecName: UvrABC system protein B
Begin-End: 429-545
Organism: Bacillus caldotenax
Interaction Mode:   

Sequence:
GQIDDLIGEIRERVERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERIEII
RDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNA
Structures of the domain P56981 429-545
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2fdc X-ray 3.3 A 435-544 None
2fdc X-ray 3.3 B 435-544 None


© NPIDB team 2003 - 2019

text