Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P57743
RecName: U6 snRNA-associated Sm-like protein LSm3
Begin-End: 6-78
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEM
VFIRGDTVTLIST
Structures of the domain P57743 6-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 C 7-77 None
6aso X-ray 2.71 C 7-77 None
4m7a X-ray 2.78 J 7-77 None
4m7a X-ray 2.78 C 7-77 None
4m7a X-ray 2.78 J 7-77 None
4m7a X-ray 2.78 C 7-77 None
4m7d X-ray 2.6 J 7-77 None
4m7d X-ray 2.6 C 7-77 None
3jcm X-ray 3.8 d 48-77 None


© NPIDB team 2003 - 2019

text