Pfam domain
Pfam family: Fibrillarin (PF01269.16)
Uniprot AC: P58032
RecName: Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
Begin-End: 6-231
Organism: Sulfolobus solfataricus
Interaction Mode:   

Sequence:
TVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAI
LKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRP
NIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAIYNAKFFLKVNGDMLLVIKARS
IDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
Structures of the domain P58032 6-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3id5 X-ray 4.01 F 8-231 None
3id5 X-ray 4.01 B 8-231 None
5gip X-ray 3.13 E 8-231 None
5gip X-ray 3.13 F 8-231 None
5gip X-ray 3.13 O 8-231 None
5gip X-ray 3.13 P 8-231 None
3pla X-ray 3.15 M 8-231 None
3pla X-ray 3.15 F 8-231 None
3pla X-ray 3.15 E 10-231 None


© NPIDB team 2003 - 2019

text