Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P60240
RecName: RNA polymerase-associated protein RapA
Begin-End: 490-601
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RVEWLMGYLTSHRSQKVLVICAKAATALQLEQVLREREGIRAAVFHEGMSIIERDRAAAW
FAEEDTGAQVLLCSEIGSEGRNFQFASHMVMFDLPFNPDLLEQRIGRLDRIG
Structures of the domain P60240 490-601
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s20 X-ray 4.7 K 495-601 None
4s20 X-ray 4.7 L 495-601 None


© NPIDB team 2003 - 2019

text